Protein Info for Shew_3436 in Shewanella loihica PV-4

Annotation: methylation site containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF07963: N_methyl" amino acids 7 to 32 (26 residues), 38.8 bits, see alignment 2.3e-14 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 10 to 32 (23 residues), 36.4 bits, see alignment 1.5e-13

Best Hits

KEGG orthology group: K02650, type IV pilus assembly protein PilA (inferred from 100% identity to slo:Shew_3436)

Predicted SEED Role

"Type IV pilin PilA" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIK4 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Shew_3436 methylation site containing protein (RefSeq) (Shewanella loihica PV-4)
MKGIKKTNAKGFTLIELMIVVAIIGILAAIALPAYKEYVNKGKINACLGEATAYVKAASA
AVIGETTIPDFAPTSCTGAITKPTNLASLTGTATTKAQDENTTTISCDWPTATCKAS