Protein Info for Shew_3410 in Shewanella loihica PV-4

Annotation: permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 335 to 390 (56 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details amino acids 439 to 460 (22 residues), see Phobius details PF03773: ArsP_1" amino acids 5 to 419 (415 residues), 159.8 bits, see alignment E=4.5e-51

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to slo:Shew_3410)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIH8 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Shew_3410 permease (RefSeq) (Shewanella loihica PV-4)
MLLSNFIDLFLDSAPWLLLGLVLAGMLKMFVPMTWMQKQLGGHGVKTTIKAAVLGAPLPL
CSCGVIPAAVGLRRSGASKAATTSFLVSTPETGIDSVSVSYVLLGPFMAVVRPIAAVTSA
IVAGLLVGRDDDEAKAAEVAHSAGSKRDEADKAEASSSCCSSKPAQKSLEKAESSSCCGD
KPSAPVRMTTDASPMMMRLVSSDAILKQEALVKPVAAPTSVNPASGSCCASKAAPEPVSS
CCSSKQEVKSASSCCSSAKGDSQNAQGESCCESIKDVASELKGTSVLARMGKGLHYAATD
LVRDTTVWLLIGLFFAALVQTYVPGDFMAKWGDGILAMLVMVLISVPMYICATASTPIAA
GLLLAGVSPGAVLVFMLAGPATNIATLGVVTKELGKRALYGYLGGVLGVALVAGVLVNYL
VATFGFEVMPQVGEQHNLLPSLVVNASGIILAILMLKVLLAKLPKNWWRRDCCS