Protein Info for Shew_3402 in Shewanella loihica PV-4

Annotation: ABC transporter-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF00005: ABC_tran" amino acids 26 to 166 (141 residues), 117.6 bits, see alignment E=6.7e-38 PF13304: AAA_21" amino acids 136 to 196 (61 residues), 27.8 bits, see alignment E=2.8e-10

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 100% identity to slo:Shew_3402)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosF (ATPase)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIH0 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Shew_3402 ABC transporter-related protein (RefSeq) (Shewanella loihica PV-4)
MQASSPSRPIVSLSGVAKRYAKVSALERIDFELFPGEVMGLFGHNGAGKTTIMKLILGII
PASDGQVKVFGQDPLSKQAFEARKQVGYLPENVSFYDQLTGREVLRYFARLKSVPKQAIE
QLLEQVGLTHAMDRQVKTYSKGMRQRLGLAQAFLGSPKLLLLDEPTVGLDPIATQEFYAS
VDKLKSEGASIILCSHVLPGVEQHIDRALIISGGRLLAKGSLSELRQQAQLPVAIKTQGL
NGALKQDARFTPYLIAPDQLLVPEQEKLAIIRQLVELDQLGDIRVEPADLERVYQHYLGQ
RPSKAHKGDNEIEISHQGGQIQ