Protein Info for Shew_3399 in Shewanella loihica PV-4

Annotation: FMN-binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 422 to 443 (22 residues), see Phobius details amino acids 455 to 480 (26 residues), see Phobius details amino acids 493 to 513 (21 residues), see Phobius details amino acids 521 to 535 (15 residues), see Phobius details amino acids 556 to 576 (21 residues), see Phobius details amino acids 596 to 613 (18 residues), see Phobius details PF04205: FMN_bind" amino acids 92 to 179 (88 residues), 34.7 bits, see alignment E=3.3e-12 PF12801: Fer4_5" amino acids 496 to 541 (46 residues), 52.4 bits, see alignment 6.1e-18 amino acids 599 to 633 (35 residues), 26.2 bits, see alignment (E = 9.2e-10) PF27538: NosR" amino acids 644 to 699 (56 residues), 77.7 bits, see alignment 7.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3399)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosR" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIG7 at UniProt or InterPro

Protein Sequence (713 amino acids)

>Shew_3399 FMN-binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MARLMHHARQAKWILLTLLALMLALMLAMPSYALFVSPPKDPQPILHELFPEATRISDKQ
GEPALWTIYKDQQILGYGFETNDIARIPAYSGEPVNILVAIDPEGKYLGAKVLEHHEPII
LAGIPESKLWKFAEQYTGLSVKDRLKVGGNEKEGIVAIDGLSGATVTVMVMNVAITKAAT
QAAIALGIIEQQADQIQPISTIKQELFTPANWTELTGDGSIRKLYLTRGAVDDAFEGTAA
EEVDKASDDEKQEMFAEIYYTLADIPTIGKNLFGEADYQWLMQTLQPGEHLVAVMGNGYS
FKGSGYVRGGIFDRIQVHQKDNAISFRDLDHNRISDLYIQGAPKFNEMSVFRIAQHHEFD
PGSSWQFELLVRRQTGPIDSIFTSFKGQYDPLGKYVDTPAAIVPEPELTMVQQIWHDRQL
EVVLLLILMGVLLLILFFQDILVRHPTFMHRLRHGFLVVTVVVIGWSWGGQLSVVNVFTF
LHALMKDFSWDLFLLDPIIFILWCAAAVTMLLWGRAVYCGWLCPFGALQELVNVMGRYFK
LPQVELPFAVHERLWAIKYLILLALFGLSLDSLAMAEQFAEIEPFKTTFLLKFDREWPFI
LWALLMIFSSLFNRKTFCRYLCPLGAALSVSNSVRLFDWLKRRPECGTPCKTCAKECEIQ
AIHPNGVINMRECHYCLDCQVTYFNEEKCPPLKKLARKRQQYKDQEIPTVTAV