Protein Info for Shew_3330 in Shewanella loihica PV-4

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 226 to 386 (161 residues), 154.5 bits, see alignment E=1e-49 PF00990: GGDEF" amino acids 228 to 384 (157 residues), 156.1 bits, see alignment E=3.4e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3330)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI98 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Shew_3330 diguanylate cyclase (RefSeq) (Shewanella loihica PV-4)
MNIDPIAELLVLFICLLASTSTLAWGLMAYPLRIAPRASTYFSLANLLILTGVLLTTLRD
QTPSYLYWLGADMLLLLGFVLLRSGTQRLFRLSSSIKIDLALLLLTGLSMLTQPPSIAAS
DTLGIFFSFMAASTFLLMAKDNLVALEHTVKRPIAVILLSPIALMGVIFGLRALLLLIEP
ALKSHLASIQSADAIPMLWLYVVMTLWINVIMMGNALTRLVQKMRQQADRDYLTGLWNRR
AMQQQLEQLHQRWLRDGQAYSLILFDLDFFKQINDKFGHSAGDAVLVKTAQQIGKVTRAM
DIFCRLGGEEFLLVLPGTDGEVAEIIAQKLQQALRQSSLNWQGSLIPISASFGIVTTATG
DTPDSLLALADKAMYRAKETGRDRCCTAERRLEQAQATPSQ