Protein Info for Shew_3327 in Shewanella loihica PV-4

Annotation: RNA-metabolising metallo-beta-lactamase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00753: Lactamase_B" amino acids 15 to 122 (108 residues), 36.8 bits, see alignment E=1e-12 PF16661: Lactamase_B_6" amino acids 20 to 171 (152 residues), 28.3 bits, see alignment E=2.7e-10 PF12706: Lactamase_B_2" amino acids 26 to 219 (194 residues), 33.2 bits, see alignment E=9.9e-12 PF10996: Beta-Casp" amino acids 256 to 381 (126 residues), 113.4 bits, see alignment E=2.5e-36 PF07521: RMMBL" amino acids 395 to 450 (56 residues), 62.3 bits, see alignment 8.9e-21

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 100% identity to slo:Shew_3327)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI95 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Shew_3327 RNA-metabolising metallo-beta-lactamase (RefSeq) (Shewanella loihica PV-4)
MQMTLSFLGAAQEVTGSCHLLDISGRQVLLDCGLIQGGKLDALRNHEPFLFEPTEIHAVV
LSHAHIDHSGRLPLLVKSGFTGPIYTHKATVELCEVMLRDAAMLQVRDVERLNKKRVKMD
LPPLEPLFDEEDVALVIKQFVALDYGQSVKVVPQLTACLSDAGHILGSAVVELWLGEGSE
RKKLVFSGDLGRAGMPILDDPTLIDDADLVLMESTYGDRLHRSWDDTLAELKAIFAKTIK
ESRGNILLPAFSVGRAQELLYLFHLYAKEWALSNWRICLDSPMAIKATQIYVANYQLMDE
DFKRFTRLSPGKHPLLSNVDFIDSTQESMELNEIHQGLIIIAGSGMCNGGRIRSHLEHNL
ANPQSDVIICGFQALGTPGRLLVDGAESLTIHGRDIPVKAKIHTVGGLSAHADQAELIHW
YRHFKHTPPLILIHGEREAQQRLKAELVPEGSQSPHVVIAERGDTLDLTALPELVWLLDR
D