Protein Info for Shew_3326 in Shewanella loihica PV-4

Annotation: sodium/hydrogen exchanger (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 394 (381 residues), 132.5 bits, see alignment E=9.5e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3326)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI94 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Shew_3326 sodium/hydrogen exchanger (RefSeq) (Shewanella loihica PV-4)
MDEHIVILIIALVVLLYGYISKWLARFDISGPMVFTAFGLLLSPFGLDVTQVKVDAEFVT
IMVEIALVLVLFSDAALLDLRLLKQSWQLPARLLFIGLPITVAAGTLVAGLIFPDQPFLY
LLMLALLLTPTDAALGKAVVSDPKVPKTIRSTINVESGLNDGIIFPVLITVVALIMSGLD
HAQDQHWLVYVMQQILFGALVGGAVGYLGTKLQIFCFKRDGMVETYLNLIPIALAILAFY
LAEEFSGNGFIAAFFAGLYAGNTSEMARGHIEDFAESEGELLVLISFFIFGLAFVPTTLP
YVTMEVIIYALLSLTLLRMLPVMISLIGTKLDLATRAFIAWFGPRGIASILYVLIVAHEM
GSIKGFETLYAVVTVTVLMSILAHGLSAQPLANWYAKRHRPAEPDTDGEDSTA