Protein Info for Shew_3322 in Shewanella loihica PV-4

Annotation: transporter DMT superfamily protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details PF00892: EamA" amino acids 10 to 146 (137 residues), 48.1 bits, see alignment E=7.2e-17 amino acids 156 to 287 (132 residues), 30.1 bits, see alignment E=2.8e-11 TIGR00688: protein RarD" amino acids 10 to 263 (254 residues), 156.1 bits, see alignment E=6.1e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3322)

Predicted SEED Role

"RarD protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI90 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Shew_3322 transporter DMT superfamily protein (RefSeq) (Shewanella loihica PV-4)
MPSHTQVSAKGNALAIVSFLLWGLLPLYYQFLPGADITEMLAIRLLCSVPFMLLVFLLLG
KPLPSLALLRTNLPSVALCALASLIMCVSWYSFTWALTHGQVLAASLGFFINPLFAIGLG
VLFLKDRLTVAQKWAVLLGTLGIGYMVMAYAQLPWLALLMGSFFALYGLCKKFIRFDSLT
SVTIEAALLTPIAAGYLFWLSATGQSEALSSGTGTMLLYMGSAPVTLLPLIFFALAIRHT
SLSMVGLLQYIEPTMHFLLAIFLFNETFDSVKAVSFALIWVGLLLCSLEALHGLWRSLTT
RRQLHHPS