Protein Info for Shew_3305 in Shewanella loihica PV-4

Annotation: CaCA family Na(+)/Ca(+) antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 104 to 120 (17 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 2 to 312 (311 residues), 260.2 bits, see alignment E=1.2e-81 PF01699: Na_Ca_ex" amino acids 5 to 145 (141 residues), 109.1 bits, see alignment E=1e-35 amino acids 173 to 317 (145 residues), 114.7 bits, see alignment E=1.9e-37

Best Hits

Swiss-Prot: 52% identical to CAXA_ALKAM: Putative antiporter CaxA (caxA) from Alkalimonas amylolytica

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to slo:Shew_3305)

Predicted SEED Role

"Inner membrane protein YrbG, predicted calcium/sodium:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI73 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Shew_3305 CaCA family Na(+)/Ca(+) antiporter (RefSeq) (Shewanella loihica PV-4)
MLFNIFLLIAGLGALVWSADKFVFGAAAFARNLGLPPMLIGLTIVAMGSSAPEMFVAATA
SLEGMTDTAIGNVLGSNVANITLILGITALLGAISVSSQTLKREIPMMLGATALAGYFLH
DGQLTRVEGLVLMALFFALMGYLIWHAIVNKEKDPLIDEAESEVPKDVPTPKAILWLVIG
LVLLPLSADWMVQGAVGIAKAFHMSDLVIGLTIIAVGTSLPELAACVAGVLKKEDDLAIG
NVVGSNLFNILAVLALPALIAPGAVDAAASSRDFYMVMATSVALAILILLTGKARQLRPW
HGGVLLATFIAYQVTLFLS