Protein Info for Shew_3296 in Shewanella loihica PV-4

Annotation: protease Do (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 39 to 448 (410 residues), 503.2 bits, see alignment E=3.3e-155 PF13365: Trypsin_2" amino acids 92 to 227 (136 residues), 108.2 bits, see alignment E=1.9e-34 PF00089: Trypsin" amino acids 93 to 253 (161 residues), 71.6 bits, see alignment E=2.6e-23 PF00595: PDZ" amino acids 264 to 344 (81 residues), 57.9 bits, see alignment E=3.4e-19 amino acids 381 to 437 (57 residues), 36.7 bits, see alignment 1.4e-12 PF13180: PDZ_2" amino acids 266 to 354 (89 residues), 56 bits, see alignment E=1.2e-18 amino acids 377 to 444 (68 residues), 39 bits, see alignment E=2.5e-13 PF17820: PDZ_6" amino acids 292 to 331 (40 residues), 47.1 bits, see alignment 4.5e-16 amino acids 389 to 438 (50 residues), 34.7 bits, see alignment 3.5e-12

Best Hits

Swiss-Prot: 57% identical to DEGQ_ECOLI: Periplasmic pH-dependent serine endoprotease DegQ (degQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3296)

MetaCyc: 57% identical to periplasmic serine endoprotease (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Outer membrane stress sensor protease DegQ, serine protease" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI64 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Shew_3296 protease Do (RefSeq) (Shewanella loihica PV-4)
MKTKLSLLSAALLGASLMVMPAVSQAAIPLAVEGQALPSLAPMLEKTTPAVVAVAVSGTH
VSKQRLPDAFRYFFGPNAPREQVQERPFKGLGSGVIIDAKKGYIVTNNHVIEGADEILIG
LHDGREIEAKLIGTDAESDVALLQIEAKNLVALKRADSDELKVGDFAVAIGNPFGLGQTV
TSGIVSAMGRSGLGIEMLENFIQTDAAINSGNSGGALVNLNGELIGINTAIVAPGGGNVG
IGFAIPANMVNNLVDQLIEHGEVRRGVLGVSGRDLDSELAQGFGLDSQHGGFVNEVMPDS
AADKAGIKAGDIIVSVNDKPIKSFQELRAKIGTMGAGAKVKLGLIRDGDEKTVTAVLGEA
SQQTETAAGAVHPMLAGATLENNKKGVEITEIAQGSPAAASGLLKGDIIVGVNRTRIEDL
KELKAELKEQHGAVALKLLRGDNSLYLVLR