Protein Info for Shew_3292 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 62 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details PF09838: DUF2065" amino acids 6 to 60 (55 residues), 64.9 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 42% identical to YJET_ECO57: Uncharacterized protein YjeT (yjeT) from Escherichia coli O157:H7

KEGG orthology group: K09937, hypothetical protein (inferred from 100% identity to slo:Shew_3292)

Predicted SEED Role

"Putative inner membrane protein YjeT (clustered with HflC)" in subsystem Hfl operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI60 at UniProt or InterPro

Protein Sequence (62 amino acids)

>Shew_3292 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MTFQLLMLVLAIVLIIEGIGPLLFPNRWRAYLQEISSQNQRVLQRLGGALVTAGVVILII
FS