Protein Info for Shew_3271 in Shewanella loihica PV-4

Annotation: galactokinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR00131: galactokinase" amino acids 7 to 381 (375 residues), 393.1 bits, see alignment E=6.3e-122 PF10509: GalKase_gal_bdg" amino acids 11 to 58 (48 residues), 79.5 bits, see alignment 1.6e-26 PF00288: GHMP_kinases_N" amino acids 95 to 181 (87 residues), 63.6 bits, see alignment E=2.5e-21 PF08544: GHMP_kinases_C" amino acids 280 to 361 (82 residues), 45.7 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 50% identical to GAL1_VIBCB: Galactokinase (galK) from Vibrio campbellii (strain ATCC BAA-1116 / BB120)

KEGG orthology group: K00849, galactokinase [EC: 2.7.1.6] (inferred from 100% identity to slo:Shew_3271)

Predicted SEED Role

"Galactokinase (EC 2.7.1.6)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.6

Use Curated BLAST to search for 2.7.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI39 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Shew_3271 galactokinase (RefSeq) (Shewanella loihica PV-4)
MSNTAQRANKLFVQTFGTTADDLYQAPGRVNLIGEHTDYNDGFVLPAAINFRTVIAVKQR
DDDKFRAVSDAFPGKIYTWHFGQEGEMDPNDSWINYLKGFTAAVSASGLPAKGMDLAVVG
SVPLGAGLSSSAALEIAFGTALNDCSQLRLSPLAVAQMAQRGENQYVGCACGIMDQMISA
MAQEEHALLIDCEDLDCEPVPIPESLSLIIVNSNVPRGLVDSEYNLRREQCEQVAEHFGI
ESLRHLELRTLEGAKDELPEVCYRRARHVLSENRRTQNAAHALEAGNIAKLSELMAQSHQ
SMRDDFEITVPEIDKLVEIIDAVVGDRGGVRMTGGGFGGCVVALVDHDLTDAVVEAVERQ
YQAATGLEASVYLCSASQGASRLDEELY