Protein Info for Shew_3270 in Shewanella loihica PV-4

Annotation: SSS family solute/sodium (Na+) symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 311 to 336 (26 residues), see Phobius details amino acids 360 to 377 (18 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details amino acids 439 to 460 (22 residues), see Phobius details PF00474: SSF" amino acids 38 to 422 (385 residues), 129.9 bits, see alignment E=5.9e-42 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 38 to 422 (385 residues), 232.5 bits, see alignment E=4.8e-73

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to slo:Shew_3270)

Predicted SEED Role

"Predicted sodium-dependent galactose transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI38 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Shew_3270 SSS family solute/sodium (Na+) symporter (RefSeq) (Shewanella loihica PV-4)
MEQTIQVAIFVALTTLVALITYLKCRKVTRDANDSRDYFLAGGGLSWIVVAGSLMMTNIS
AEQIVGMNGAQTLLVAWWEIAAAIGLIILAKWLIPIYYRYNCTTTTELLERKYQDKGIRA
MVSLLFMLGYAFILLPVVLYTGSLFMKSMFGLSISVTVLAIIFAVVGAIYAIFGGLRAIA
ISDTLNGLGLILMGLAVSYLAMHAVDWDLSGIPLERLTLIGDSQSDIPWSTLLTGMIFIQ
IFYWGTNMVITQRALAAKSVKEAQKGLYAAVVMKLIIPVIVVLPGIVAFKLYGDVGDVAY
GKLVGDLLPSWLSGAFAAVIAGAVLSSFNSCLNSAAALYTCDIHQNYINADADVRKIGSR
VALLFTLISVALVPLFARSESIIALLQQLNGLYSMPVLAAFICALVFKNVSAKAIKWGLV
FGVLLYALFTFIWSPLHFIHLMAITLLATILVTLVFSRLFAQPVIAPVAEPTLD