Protein Info for Shew_3258 in Shewanella loihica PV-4

Annotation: two component heavy metal response transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR01387: heavy metal response regulator" amino acids 16 to 234 (219 residues), 330.1 bits, see alignment E=3.2e-103 PF00072: Response_reg" amino acids 16 to 126 (111 residues), 96.6 bits, see alignment E=1.1e-31 PF00486: Trans_reg_C" amino acids 160 to 234 (75 residues), 93.9 bits, see alignment E=5.2e-31

Best Hits

Swiss-Prot: 58% identical to CUSR_ECOL6: Transcriptional regulatory protein CusR (cusR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07665, two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR (inferred from 100% identity to slo:Shew_3258)

Predicted SEED Role

"Copper-sensing two-component system response regulator CusR" in subsystem Cobalt-zinc-cadmium resistance or Copper homeostasis or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QI26 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Shew_3258 two component heavy metal response transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MQIGLNKLKACRQMRILVIEDEIKIGDYLKKGLEEAGYTISLCRNGLDGYHCAISEHFDL
IILDVMLPDMNGWQILEKIRLNNSDIPVMFLTAKDSLEDKINGLESGADDYLVKPFAFAE
LLARVKTLLRRGTKQLQSDTLTLHGLKLDITKRRASREQTKLHLTNKEFSLLELLVRHQG
EVLTRSFIASQVWDMNFDSDTNVIDVAIRRLRAKVDDPFSVKLIHTVRGMGYKLDTEA