Protein Info for Shew_3220 in Shewanella loihica PV-4

Annotation: Beta-lactamase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF00905: Transpeptidase" amino acids 47 to 262 (216 residues), 130.3 bits, see alignment E=4.4e-42

Best Hits

Swiss-Prot: 41% identical to BLO10_PSEAI: Beta-lactamase OXA-10 (bla) from Pseudomonas aeruginosa

KEGG orthology group: K01467, beta-lactamase [EC: 3.5.2.6] (inferred from 100% identity to slo:Shew_3220)

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHY8 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Shew_3220 Beta-lactamase (RefSeq) (Shewanella loihica PV-4)
MLSWAGGAAAVPQTGPDKPAAEQESAGALRLDGEIQAVFDAVGAKGVMVLLDDKGGKLLT
NDAARSQHPYIPASTFKIPHSLLLLEAGIVEDEHSRFAWDGVKRTYSPWNRDHNFIGAMK
YSVVPIYQKLALQLGAERMASGLENLDYGNANIGGGLDSFWLDGDLAISALEQVHFLRRL
YHNRLPLSERSQRIVKTMMLNEANGDWVLRAKTGYGVRKGQKLGWWVGWLEREENTYFFA
MNMDITSDKDLALRKRVVKHLLKAKGWM