Protein Info for Shew_3202 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 314 to 340 (27 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 418 to 435 (18 residues), see Phobius details amino acids 441 to 461 (21 residues), see Phobius details amino acids 487 to 508 (22 residues), see Phobius details amino acids 721 to 741 (21 residues), see Phobius details amino acids 762 to 791 (30 residues), see Phobius details amino acids 811 to 834 (24 residues), see Phobius details PF02687: FtsX" amino acids 274 to 397 (124 residues), 32.7 bits, see alignment E=6.4e-12 amino acids 724 to 840 (117 residues), 49.7 bits, see alignment E=3.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3202)

Predicted SEED Role

"AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHX0 at UniProt or InterPro

Protein Sequence (850 amino acids)

>Shew_3202 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MSSLVVNSQAGGVKALLRATRLTLRVFAAHYKKAPLQAGAILIGIVLAVTLLTGVRATNE
SAIDSYGQASELLSGQASNLVTPLPGKALSDSLYFDLRTQGFHHSLAVLQGSALDSAQHR
WQVTGSDLIAALSAITPSNSDRPQTVEPSDSKIPMSGPLPLAAMLAGEPIVVMSEANAKR
LQEPWLSLNDMRLKVMAVDESYQLGDRLLMDISLAQQLLGKPGELSYIALFDPPGEHQQQ
LLTSLLTGRGELVESDNGEAMKALTNSFHLNLTAMSLLAFIVGLFIAYNGVRYSLLKRKR
LIIQLQQQGVRRAAIMFALGLELTLLVLLGSLIGFILGLQLSFWLQPMVSVTLEQLYGAN
ILPGSWRWQWLAQASLLTLIAALLACGSLLRELLNQPLAQSSGQLSQQRSSQLAQNRLML
LACLLGIMTLILMPLSQDYRFTMTLLGLVVIAIPLALPYLLRQLIGLLQKISPKGLIGYQ
ISETRELLAPLSLAMMAMLLALTANIAMNSLVGSFEITLKQWLDARLHAQLYLRPPASQM
AEVEKMLSQAPEVTGLYKQWLLKSHYQQTPIFLLTRDPYSIEHTTIIKQAKPDLWRDFFS
ADPETKPLALISEPFAIKQGKQLGDKIRIAALGETELTIGAIYYDYGNPYGEVIIPPSLW
RRANLGETPLSLALTLSTDVTRFSQQIQTRFQLPDALVYSQEKIKAQAITMFKRTFSITQ
VLNSLTLMVAAIGLFSACYMLTQARLAPIARLYALGVNRRQLVWLVVGQMLLMVLLTCLV
ALPTGALLGYLLIHKVTLQAFGWTIAMVWDWLAYLELVGLALLASTLALAFPLYQQTRRP
LVSSLQREVI