Protein Info for Shew_3199 in Shewanella loihica PV-4

Annotation: response regulator receiver modulated metal dependent phosphohydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00072: Response_reg" amino acids 6 to 116 (111 residues), 94.2 bits, see alignment E=8.9e-31 PF13487: HD_5" amino acids 155 to 317 (163 residues), 127 bits, see alignment E=9.6e-41 PF01966: HD" amino acids 164 to 285 (122 residues), 82.2 bits, see alignment E=5.4e-27

Best Hits

Swiss-Prot: 42% identical to CDPD2_PSEAE: Cyclic di-GMP phosphodiesterase PA4781 (PA4781) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07814, putative two-component system response regulator (inferred from 100% identity to slo:Shew_3199)

Predicted SEED Role

"Response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHW7 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Shew_3199 response regulator receiver modulated metal dependent phosphohydrolase (RefSeq) (Shewanella loihica PV-4)
MEKATVLVVDDTPENIDILVGILGDEYKVKVAIDGPKALAIAGKSAPDIILLDVMMPGMN
GYEVCKRLKQEPLTAHIPVIFVTALTDVADETQGFELGAVDYITKPVSAPVVKARVKTHL
SLYDQKRLLEQEVKARTRELEVTRLEIIRRLGRAAEYKDNETGMHVIRMSHYARLLAREA
GMSEHFCELIYNASPMHDIGKIGTPDAILKKPAKLDDEEWREMQRHAEIGAEIIGEHPDP
MLEMARRIALTHHEKWDGSGYPKGLSGEEIPIEGRIVAIADVFDALTSIRPYKQAWSVED
TLALIDREAGKHFDPELVSHFKAIVDEAVKIRDSHQDKE