Protein Info for Shew_3180 in Shewanella loihica PV-4

Annotation: pseudouridine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF00849: PseudoU_synth_2" amino acids 70 to 194 (125 residues), 58 bits, see alignment E=6.9e-20 TIGR00093: pseudouridine synthase" amino acids 97 to 227 (131 residues), 141.8 bits, see alignment E=7.9e-46

Best Hits

KEGG orthology group: K06183, ribosomal small subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 100% identity to slo:Shew_3180)

Predicted SEED Role

"Similar to ribosomal large subunit pseudouridine synthase F, group RluF2"

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.12

Use Curated BLAST to search for 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHU8 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Shew_3180 pseudouridine synthase (RefSeq) (Shewanella loihica PV-4)
MRLAQYLALTGRCSRRAASRLIRNGRVSLGDRLAKHTDSIELIETPTGTQASLSVCVDGE
PLPPIADKAYWIFNKAVGTDCRLLAEDTTSLIHLLPRQPRLYPVGRLDKDSRGLLLLTND
GELTQRLMHPSFAHHKRYHVRLDRPFDDDFVVKMAAGVSYKDVTTQPCQVTRLGQDSFEI
VLTQGLNRQIRRMSKTLGHKVIDLKRVAIESLTLGDLPEGEMRPLTQAELDELWCDLA