Protein Info for Shew_3144 in Shewanella loihica PV-4

Annotation: UDP-N-acetylmuramate (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 21 to 474 (454 residues), 731.3 bits, see alignment E=2.3e-224 PF01225: Mur_ligase" amino acids 21 to 122 (102 residues), 83.3 bits, see alignment E=1.9e-27 PF08245: Mur_ligase_M" amino acids 131 to 317 (187 residues), 66.3 bits, see alignment E=5.7e-22 PF02875: Mur_ligase_C" amino acids 338 to 406 (69 residues), 45.4 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 64% identical to MPL_ECOLI: UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (mpl) from Escherichia coli (strain K12)

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 100% identity to slo:Shew_3144)

MetaCyc: 64% identical to UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptanedioate ligase (Escherichia coli K-12 substr. MG1655)
RXN0-2361 [EC: 6.3.2.45]; 6.3.2.45 [EC: 6.3.2.45]

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.- or 6.3.2.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHR2 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Shew_3144 UDP-N-acetylmuramate (RefSeq) (Shewanella loihica PV-4)
MVTRIVRITPRLFLSRANPMHVHILGICGTFMGGLALLARANGHKVTGSDANVYPPMSTQ
LEEQGIELIQGFDPSQLGQNEDDAPDLVVIGNAMSRGNPCVEAVLNRGLKYTSGPQFLAE
HILTNRWVLAVSGTHGKTSTSSMLAWILEDCGYAPGFLIGGVPQNFGVSARLGDSPFFVV
EADEYDSAFFDKRSKFVHYQPRTLVINNLEFDHADIFDDLKAIQRQFNHVIRTVPGQGKV
IWPSASDAVREVIDMGCWSEQETYNLMAGSPGWYSELLSEDGHSFELFFDGESQGVLDWS
LIGQHNVENATMAIAAARHVGVKPAAAIEALTRFAPPKRRMELIGTVNDIAVYDDFAHHP
TAIATTLQGCRAKVGEGRIIVVLEPRSNTMKRGVHKDTLAGSMALADAAYLYQADNIDWD
VEAAMAKAELPVTVLYQIDELADSVTAAARPGDTIIVMSNGGFGGLHGKLLAKLEEIKA