Protein Info for Shew_3143 in Shewanella loihica PV-4

Annotation: aromatic acid decarboxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02441: Flavoprotein
  • amino acids 9 to 197 (189 residues), 129.4 bits, E=5e-42
• TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases
  • amino acids 88 to 207 (120 residues), 156.3 bits, E=3.6e-50

Best Hits

Swiss-Prot: 59% identical to UBIX_PSEAE: Flavin prenyltransferase UbiX (ubiX) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 100% identity to slo:Shew_3143)

MetaCyc: 59% identical to flavin prenyltransferase (Pseudomonas aeruginosa)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• prenylated FMNH₂ biosynthesis (2/3 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Sequence Analysis Tools

See A3QHR1 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Shew_3143 aromatic acid decarboxylase (RefSeq) (Shewanella loihica PV-4)
MNYPKRAKAISLAWTGASGAPYGLKLLECLLMADYQVFLMISSAARVVLATEHGLQLSAN
GDKAKAQLLALFAERGNEAAGELHVLGKEEWFSPPASGSAAPKQMVICPCSTGTLAAVAT
GMSNSLLERAADVVIKERGQLILVPRETPFSSIHLEHMLSLSRLGATIMPAAPGFYHDPK
SVEDLVDFMVARILDHLGVDHGLTKRWGYDKHSADNRDN