Protein Info for Shew_3142 in Shewanella loihica PV-4

Annotation: hypoxanthine phosphoribosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01203: hypoxanthine phosphoribosyltransferase
  • amino acids 7 to 172 (166 residues), 229.2 bits, E=1.2e-72
• PF00156: Pribosyltran
  • amino acids 12 to 159 (148 residues), 93.9 bits, E=3.3e-31

Best Hits

Swiss-Prot: 67% identical to HPRT_VIBHA: Hypoxanthine phosphoribosyltransferase (hpt) from Vibrio harveyi

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 100% identity to slo:Shew_3142)

MetaCyc: 66% identical to hypoxanthine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• adenine and adenosine salvage III (4/4 steps found)
• superpathway of guanine and guanosine salvage (3/3 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• adenine salvage (2/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.8

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See A3QHR0 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Shew_3142 hypoxanthine phosphoribosyltransferase (RefSeq) (Shewanella loihica PV-4)
MKHTTEVMISADEIEQQLDILAAQINAHYANSERLLMVGLLKGSVVFMADLCRRIKGHVE
IDFMSVSSYGNAMTSSRDVKILKDVQSDIEGRDVLIVEDLIDSGNTLNKVREMLLLREPK
SLALCTLLDKPERREVDVPVDFIGFTIPDEFIVGYGIDYAEQYRNLPYIAKVVPLD