Protein Info for Shew_3140 in Shewanella loihica PV-4

Annotation: ABC-2 type transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 178 to 204 (27 residues), see Phobius details amino acids 224 to 254 (31 residues), see Phobius details PF01061: ABC2_membrane" amino acids 14 to 224 (211 residues), 129 bits, see alignment E=1.9e-41 PF12698: ABC2_membrane_3" amino acids 63 to 252 (190 residues), 41.3 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 66% identical to YADH_ECO57: Inner membrane transport permease YadH (yadH) from Escherichia coli O157:H7

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to slo:Shew_3140)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHQ8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Shew_3140 ABC-2 type transporter (RefSeq) (Shewanella loihica PV-4)
MSSSMNMKHVYFTAFKSILIKEVTRFTRIWVQTLVPPAISMTLYFLIFGNLVGKRIGEMG
GVSYMEFIAPGLIMMSVITASYSNVASSFFSAKFQRNLEELIVAPVPHYVMIAGYVGGGV
ARGLCVGTIVTLVAMFFVDISLHHAGLVALTVLLTSILFALGGLINAVFAKSYDDISIVP
TFVLTPLTYLGGVFYSLTLLPSFWQGVSQLNPVVYMINVFRYGFLGYADISIGLSVAIMV
GFCAGLWLVAYYLISRGIGLRT