Protein Info for Shew_3134 in Shewanella loihica PV-4

Annotation: pantoate--beta-alanine ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF02569: Pantoate_ligase" amino acids 4 to 277 (274 residues), 362.6 bits, see alignment E=5.3e-113 TIGR00018: pantoate--beta-alanine ligase" amino acids 4 to 278 (275 residues), 349.2 bits, see alignment E=1.3e-108 TIGR00125: cytidyltransferase-like domain" amino acids 24 to 68 (45 residues), 34.4 bits, see alignment 1.9e-12

Best Hits

Swiss-Prot: 100% identical to PANC_SHELP: Pantothenate synthetase (panC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 100% identity to slo:Shew_3134)

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHQ2 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Shew_3134 pantoate--beta-alanine ligase (RefSeq) (Shewanella loihica PV-4)
MYTTQDIAAIRTQVRQWKRAGETVAFVPTMGNLHQGHITLVTEALKRADHVVVSIFVNPM
QFGQNEDLDAYPRTLAADQAALEAAGAELLFTPTPAIIYPKGMDKQTFVEVPGLSEELCG
ASRPGHFRGVATIVCKLFNIVQPDVALFGKKDFQQLMVIKAMVEDLSLPIEIVGVDTIRE
SSGLAMSSRNGYLSEAQKQQAAQLKRTLDEMAEAIAKGQAIPNVVRHAQEQLHQAGFKPD
YLSVRNAADLREAQDSDKQLVILAAAFMGSTRLIDNLSFERA