Protein Info for Shew_3113 in Shewanella loihica PV-4

Annotation: histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 251 to 272 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 21 to 236 (216 residues), 48.1 bits, see alignment E=1.5e-16 PF02518: HATPase_c" amino acids 544 to 650 (107 residues), 91.8 bits, see alignment E=5.8e-30

Best Hits

Swiss-Prot: 77% identical to Y3689_SHEFN: Putative sensor protein Sfri_3689 (Sfri_3689) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3113)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHN1 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Shew_3113 histidine kinase (RefSeq) (Shewanella loihica PV-4)
MKRLLLCLIFFSFPALSQESIVFGVHSKTAPLEWRNNGVDQGFNIELMHRIGQLTDKRII
IRRKSFQQLVKDVHNPGSDIDVIAVVSPVNLDRKLSQSDPIYATHAKAYTLQGKALINSW
TDLVGKRVAIKKGAFVDVYLSGYPQKFNRVDVDLYETGFKQLIEGEVDVVIAESFVARRL
LPLYPSVRSSSDALIYGAFNFVCNGKKAALMQEINDALRQLKLSGEYDRLVNKWFGTGRE
KVDLTSTEKRMFSLAILVAIVSASGMIYTGFISASLRRRKKALDAELIQRRRVEAEISNI
SKQFQSVLDGIPHGVTIVNRELQRLWSNDNNVHLLISEDFHYIDDQAFDLRPAVLQVLNE
QKSLIADMMYLEQYWQLQIHPIANDQVVVLLEESTEQHKLRQANEEASRLASLGELSAGI
AHEINNPTGLILHAISLFSAAIKDLNPAANYYQQQNPFWQIAGLAPSQAMEEMAVSSDTI
EEAAKRISRIVNDLKRYALPNLTQDHTLVCLNEVVEVALRLTANQTKTRQVTKLLHLPSP
RIMGDAQQLHQVLINLIQNACHACAAHEGSIQISTQVSQGRALIKVNDNGCGMDSATLKR
ITEPFFTTRRTEGGSGLGLSVCSRIIKEHQGQMQIHSAPGKGTRIQLSFALVQE