Protein Info for Shew_3112 in Shewanella loihica PV-4

Annotation: flavocytochrome c (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF14537: Cytochrom_c3_2" amino acids 32 to 112 (81 residues), 60.9 bits, see alignment E=5.9e-20 PF01134: GIDA" amino acids 153 to 345 (193 residues), 26.8 bits, see alignment E=1.2e-09 PF07992: Pyr_redox_2" amino acids 153 to 341 (189 residues), 33.7 bits, see alignment E=1.3e-11 PF00890: FAD_binding_2" amino acids 153 to 574 (422 residues), 304 bits, see alignment E=9.4e-94 TIGR01813: flavocytochrome c" amino acids 153 to 587 (435 residues), 582.7 bits, see alignment E=2.3e-179 PF12831: FAD_oxidored" amino acids 153 to 339 (187 residues), 48 bits, see alignment E=5.3e-16 PF01266: DAO" amino acids 153 to 205 (53 residues), 28.1 bits, see alignment 6.9e-10 PF13450: NAD_binding_8" amino acids 156 to 191 (36 residues), 24.5 bits, see alignment 1.2e-08

Best Hits

Swiss-Prot: 90% identical to FRDA_SHEFN: Fumarate reductase flavoprotein subunit (fccA) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: K00244, fumarate reductase flavoprotein subunit [EC: 1.3.99.1] (inferred from 100% identity to slo:Shew_3112)

MetaCyc: 90% identical to fumarate reductase (cytochrome) (Shewanella frigidimarina)
RXN-23709 [EC: 1.3.2.4]

Predicted SEED Role

"periplasmic fumarate reductase, FccA (EC 1.3.99.1)" (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.2.4 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHN0 at UniProt or InterPro

Protein Sequence (596 amino acids)

>Shew_3112 flavocytochrome c (RefSeq) (Shewanella loihica PV-4)
MKKMKLAVCLATLMGTAGFMGNAMAADNLADFHAQNQECDSCHQADGELSNDSLTYENAQ
CVSCHGTLAEVAESTKHEHYNAHDSHFPGDVSCTSCHSAHEKSMVYCDSCHSFDFNMPYA
KKWERHEPTIAELAKDKAERQAALASAPRDTVDVVVVGSGGAGFSAAVSAHDNGAKVILI
EKEPVIGGNAKLAAGGMNAAWTDQQKAKNIKDDPEIMFKDTMKGGRNINDPELVKILSSH
SKGSVDWMTGMGADLSDVGRMGGASVNRSHRPTGGAGVGAHVVQVLYDNAVKRNIDIRMN
TRGVEILKDDSGKVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVSKLDPKLKGFVS
TNQPGAVGDGIDVAANAGAAMKDLEYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRF
VNEITTRDKAAAAILQQTGKSAYLIFDDSVRKSLKKIDKYIGLGVAPSADSLEKLGKLEG
IDGKALTETVARYNSFVTSGKDADFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTK
AEVMDAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEQAADYAKKH