Protein Info for Shew_3111 in Shewanella loihica PV-4

Annotation: NAD-dependent epimerase/dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF01370: Epimerase" amino acids 3 to 144 (142 residues), 62.5 bits, see alignment E=1.1e-20 PF02719: Polysacc_synt_2" amino acids 14 to 86 (73 residues), 30.5 bits, see alignment E=5.6e-11 PF01073: 3Beta_HSD" amino acids 19 to 126 (108 residues), 49.5 bits, see alignment E=7.7e-17 PF16363: GDP_Man_Dehyd" amino acids 20 to 143 (124 residues), 32.9 bits, see alignment E=1.3e-11 PF07993: NAD_binding_4" amino acids 31 to 150 (120 residues), 26.8 bits, see alignment E=6.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3111)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHM9 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Shew_3111 NAD-dependent epimerase/dehydratase (RefSeq) (Shewanella loihica PV-4)
MKEHEVVGIDRTPCSTADVVGDIRDTALLAEALEGVEVIIHTAALHAPHVGLVPGDEFEE
INIKATEQLALMGVKKGIKHFVFTSTTALYGFASTPAGRAGWVDETVMPRPKTIYHHSKI
KAEQLLENISSSFDLPVTVLQMSRCFPEPVNLMAVYRLTRGIDARDVARAHACAVERRLS
GFRRYIISGKTPFSKACCERLYRDANDVIREAIPGLAESFAVRGWSMPQSLDRVYDSSLA
QHELGWQPKYGYESVLSLLDNESAEVLPMKSQS