Protein Info for Shew_3085 in Shewanella loihica PV-4

Annotation: Lipocalin family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF08212: Lipocalin_2" amino acids 33 to 169 (137 residues), 139 bits, see alignment E=1.2e-44 PF00061: Lipocalin" amino acids 39 to 165 (127 residues), 33.4 bits, see alignment E=4.8e-12

Best Hits

Swiss-Prot: 56% identical to BLC_VIBCH: Outer membrane lipoprotein Blc (blc) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03098, outer membrane lipoprotein Blc (inferred from 100% identity to slo:Shew_3085)

Predicted SEED Role

"Lipoprotein Blc"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHK3 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Shew_3085 Lipocalin family protein (RefSeq) (Shewanella loihica PV-4)
MRWPVTFCLICLLTLLTACTSAPKGIAPVEEFELSRYLGTWHEIARLDHSFERGLSQVTA
EYQLRGDGGVSVVNRGFDAQSQSWKTAEGKAYFVESPDIGHLKVSFFGPFYGAYVIYRLD
ADYQYAFITSFNRDYLWLLARTPEVDESVRQAFITQAEKLGFDTQALIWE