Protein Info for Shew_3018 in Shewanella loihica PV-4

Annotation: alpha/beta hydrolase fold (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 73 to 91 (19 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 5 to 246 (242 residues), 71.5 bits, see alignment E=3.3e-23 PF12146: Hydrolase_4" amino acids 8 to 237 (230 residues), 49.1 bits, see alignment E=9.8e-17 PF00561: Abhydrolase_1" amino acids 17 to 115 (99 residues), 52.8 bits, see alignment E=9.4e-18 PF00756: Esterase" amino acids 67 to 112 (46 residues), 26.7 bits, see alignment 8.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3018)

Predicted SEED Role

"FIG084569: hydrolase, alpha/beta fold family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHD6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Shew_3018 alpha/beta hydrolase fold (RefSeq) (Shewanella loihica PV-4)
MTTWVMLRGLMRDERHWQGFVERLIAAGERVITVDLPGNGRLASEQSPTSIEAYCDSVWG
QVLPHINPFRGKSVVLIGLSMGGMTALALASRYPDRIRQVVLLNSSAANLSPWYRRFRLL
PLLRAMLGGVRLKLTQLGAGLSLVEACVLQYTSLYHGDNLALIANWSRWRDEGHTSLCNG
IRQLIACARFQAPPLSSIPVTVICAAEDRLADPRCSQALASFYHTQALVLPSCGHDISLD
APEALLASLQANIIDDGGQSSH