Protein Info for Shew_3011 in Shewanella loihica PV-4

Annotation: magnesium transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 288 to 309 (22 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 390 to 415 (26 residues), see Phobius details amino acids 424 to 450 (27 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 12 to 450 (439 residues), 284.1 bits, see alignment E=9.7e-89 PF03448: MgtE_N" amino acids 33 to 131 (99 residues), 67.9 bits, see alignment E=1.5e-22 PF00571: CBS" amino acids 202 to 257 (56 residues), 39.3 bits, see alignment 1e-13 PF01769: MgtE" amino acids 322 to 445 (124 residues), 106.9 bits, see alignment E=1.3e-34

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to slo:Shew_3011)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHC9 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Shew_3011 magnesium transporter (RefSeq) (Shewanella loihica PV-4)
MTDKFQQLADKIDAALLTGDNTAIATILAEIASAEIARLLESLPPKERLSVWAQVAPKRC
AKVLLALPQPQRRALIHHTDKAKLIAGLSQMQMDELADIDADLPMPVVSAMVQAMDSQRR
QRYELVRDYPDQSAGGLMDVDISALRADVSIKAALRYLRRLRQREGQLPEHLDSLMVVDR
NNTLVGIIPLSLLVSSEMDTSISELMSTEITSFTPEMSASKVAQVFKDKDLLSAPVVDAE
HKLIGRITVDDVIDVIQDEADKALYSQAGLNNHPDLFAPIVRSASRRALWLGINLLTAFL
AAWVIGLFEAAIEKVVALAVLMPVVASMGGVAGSQTLTMVTRGLALDQINRNNIIKLIGH
EFGIGALNALLWASLVAFIALKWFGDWQLGLVFGLAMVIVLITGVLAGASIPVLLKKIGI
DPALAGGVVLTTVTDVVGFFAFLGLATLFIL