Protein Info for Shew_2995 in Shewanella loihica PV-4

Annotation: TonB family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details PF05569: Peptidase_M56" amino acids 6 to 274 (269 residues), 156.8 bits, see alignment E=7.2e-50 PF03544: TonB_C" amino acids 329 to 396 (68 residues), 64.7 bits, see alignment E=8.8e-22 TIGR01352: TonB family C-terminal domain" amino acids 330 to 397 (68 residues), 58.5 bits, see alignment E=3.3e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2995)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHB3 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Shew_2995 TonB family protein (RefSeq) (Shewanella loihica PV-4)
MISLIVNLMLPLTLLCAVILLLHRPLLARLGAHNTYMLWASVPLLLAGTLLGLLVPARLA
SPSLEQLQHYRVLAGELLSQGDNPTLNLILASIWLLGSLTLLGALLYQATQLKRLSNRAE
ALELPQALSQGPLSLTGRETSLVIKCHPEIDSPMLAGLFKPVILVPTGFTQLAPSQQAAV
LSHELKHLTRHDIAANLFGYLLATLFWFNPVCWLAYRRFRDDQELACDAEVITHMDKQQR
IAYSQTLLAYSQQAHLGMLHTHYGNKTILKERIMQMKKTHTKRPLAILGLALTLGLSGAL
INQSAIAGDKHNDEHHDKAKAPSPVMRIEPAYPAEAAKQSVEGYVQLAFDIDKQGKVSNV
SVIESSPAGVFDVEAVKALSQWRYEASPEGVSQAKVQLDFMMSAPKAEIERVRVTAG