Protein Info for Shew_2981 in Shewanella loihica PV-4

Annotation: beta-lactamase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00753: Lactamase_B" amino acids 123 to 249 (127 residues), 59.6 bits, see alignment E=1e-19 PF12706: Lactamase_B_2" amino acids 138 to 211 (74 residues), 28.2 bits, see alignment E=3.4e-10 PF14863: Alkyl_sulf_dimr" amino acids 385 to 523 (139 residues), 206.6 bits, see alignment E=4.8e-65 PF14864: Alkyl_sulf_C" amino acids 531 to 654 (124 residues), 133.6 bits, see alignment E=1.2e-42 PF02036: SCP2" amino acids 556 to 642 (87 residues), 22.8 bits, see alignment E=2.4e-08

Best Hits

Swiss-Prot: 48% identical to YJCS_ECOLI: Putative alkyl/aryl-sulfatase YjcS (yjcS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2981)

MetaCyc: 48% identical to linear primary-alkylsulfatase (Escherichia coli K-12 substr. MG1655)
RXN-15761 [EC: 3.1.6.21]

Predicted SEED Role

"Alkyl sulfatase (EC 3.1.6.-)" (EC 3.1.6.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.-

Use Curated BLAST to search for 3.1.6.- or 3.1.6.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH99 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Shew_2981 beta-lactamase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MRHLNFVVAVASLVIALPSLAATQAKPATPHTQKANAAVLKELPFQDKQDFENAKRGFMA
KPDVVTIKDAKGNVVWDLEQYKTYIADDKSAPDTVNPSLWRNAQLGMHHGLYQVTEGIYQ
IRGFDLTNITFIKGDKGWIVFDPLISPETAKAALDFINQEVGTRPVVAVVYSHSHIDHYG
GATGLVSLDEVESGKVSIIAPEHFTEHAVSENVIAGNAMGRRAVYMYGALLPRNAKGGVN
GGLGMTVSTGLAGLLLPTHEITKTGERLTIDGIDMVFQLTPGSEAPAEMNTWFPQAKALW
MAENTTNTMHNILTLRGAQVRDALIWSSFLDETIDLWGDQAEVKFQSHHWPMWGNDKIIP
YFKKQRDIYKFTHDQSVRLMNQGFTGEEISEMISLPKELEQSWSTRGYYGTLRHNSRAVY
QRYMGWYNGNPANLNNLPPEAVAKKYVQFMGGEAEVIRKARASFDEGEYRWVAEVMKHAV
FANPKSIDAKELLADALEQLGYQAESGPWRSVYLQGAYELRNGVPAAGGTQTATPDTIRA
MTPEMLFDYLAVRLDAAKAEGKQFDIEIAFSDLDSLYTLTVENAVLHHSKRKVEQPDVKL
VMSMKTMNSIQLKELSFDDAIASGEVKLTGDKALFTSFLGMLDDFNFWFNIVMP