Protein Info for Shew_2951 in Shewanella loihica PV-4

Annotation: putative lipoprotein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 7 to 250 (244 residues), 283.7 bits, see alignment E=5.7e-89 PF13525: YfiO" amino acids 34 to 236 (203 residues), 251.8 bits, see alignment E=1.1e-78 PF13512: TPR_18" amino acids 34 to 170 (137 residues), 188.8 bits, see alignment E=1.2e-59 PF13174: TPR_6" amino acids 36 to 66 (31 residues), 14.8 bits, see alignment 7.3e-06 amino acids 144 to 160 (17 residues), 13.1 bits, see alignment (E = 2.6e-05)

Best Hits

Swiss-Prot: 50% identical to BAMD_VIBCH: Outer membrane protein assembly factor BamD (bamD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to slo:Shew_2951)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH69 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Shew_2951 putative lipoprotein (RefSeq) (Shewanella loihica PV-4)
MHNFAKGAAIALLSLALAACSSKPEDDIELSKSSPEVLYSQARTSMELGNYSKAVRSLEA
LDSRYPFGPHKTQVQLDLIYAYYKLDDSASGIANIDRFIRLNPTHKDIDYVYYMRGLVNM
QSDNYMFHDMLNIDRTDRDPKAAQDAFKDFDRLIKQYPNSKYAADAQKRMQFLKNRLAKY
AITVAEYYIKMNAWSAAAVRAQTVLETYPGTPSTERALEIMATAYEELGQQKLKDHVLMV
MQSNFPNNDMLK