Protein Info for Shew_2943 in Shewanella loihica PV-4

Annotation: ribosomal-protein-alanine acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF13302: Acetyltransf_3" amino acids 5 to 124 (120 residues), 34.4 bits, see alignment E=1.2e-11 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 15 to 145 (131 residues), 109.5 bits, see alignment E=7e-36 PF00583: Acetyltransf_1" amino acids 41 to 123 (83 residues), 73.1 bits, see alignment E=8.4e-24 PF13673: Acetyltransf_10" amino acids 43 to 127 (85 residues), 55.5 bits, see alignment E=2.1e-18 PF13508: Acetyltransf_7" amino acids 44 to 125 (82 residues), 53.8 bits, see alignment E=7.4e-18 PF13420: Acetyltransf_4" amino acids 49 to 138 (90 residues), 28 bits, see alignment E=7.4e-10 PF08445: FR47" amino acids 66 to 126 (61 residues), 47.1 bits, see alignment E=6.6e-16

Best Hits

Swiss-Prot: 40% identical to RIMI_ECO57: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Escherichia coli O157:H7

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to slo:Shew_2943)

MetaCyc: 40% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH61 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Shew_2943 ribosomal-protein-alanine acetyltransferase (RefSeq) (Shewanella loihica PV-4)
MPMTLTLKTLSKEDAPKLHELESACHSFPMSLSNLETCFGRFYHVIGLFDDEEMLGFSIL
HQLFEDATLMDICVRPDAQGQGLGKRLTEALIELAATQGAERMMLEVRASNERAIALYRQ
MGFEQVGMRANYYQLEQGKEDAILMERLF