Protein Info for Shew_2935 in Shewanella loihica PV-4

Annotation: peptidoglycan glycosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 signal peptide" amino acids 21 to 23 (3 residues), see Phobius details transmembrane" amino acids 24 to 42 (19 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 21 to 610 (590 residues), 772.6 bits, see alignment E=1.4e-236 PF03717: PBP_dimer" amino acids 66 to 241 (176 residues), 150.2 bits, see alignment E=8.7e-48 PF00905: Transpeptidase" amino acids 273 to 605 (333 residues), 241.6 bits, see alignment E=1.2e-75

Best Hits

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 100% identity to slo:Shew_2935)

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH53 at UniProt or InterPro

Protein Sequence (627 amino acids)

>Shew_2935 peptidoglycan glycosyltransferase (RefSeq) (Shewanella loihica PV-4)
MAPRKRMAMHDHAAEASLFKRRAIFTFACVVVLLSILLGNLYHLQVLSYKDYETRSNDNR
IRVVPVAPSRGLIYDRHGQLLAENQPFYSLELIPEKVKDVPATLDELAKVVELSKDDRES
LVASLKYHRRFKPITVKNRLSEEEVAIFSVNQHRFPGFSIDAGLKRHYPYDGLLTHVLGY
VGRINNRDQAALQRNGQWQNYAATKDIGKQGIEKFYESLLHGMPGHLEEEVNNRGRTIRT
LKSVAPEPGQDIYLTLDLQLQKKAMELLAGRRGSIVAIDPRDGGILAMVSSPSYDPNQFV
HGISSKAYSDLLNARSRPLINRATQGQYAPASTVKPHMALLGLEEKVVTPKTRVWDPGFW
QIPGVERKYRDWKRWGHGWVDVNGALVHSCDTYFYDMAYKTGIDKISNFMQQFGFGERTG
VDIFEESAGNMPSKDWKRLKYNQPWYIGDTISVGIGQGYWTTTPLQLANATAIMANKGER
FVPHLLKSIKNDTVKVDTPVDKMAPVVLKSPHNWQIINEAMRDTAHKSRFVDAGYTAAMK
TGTAQVFSVAEDEKYDAENIDEHLRDNALIVAYAPYEAPRIVLAVVLENAGWGGANAGPV
ARALLDEYMLRDNLPLETAGSPHNERP