Protein Info for Shew_2921 in Shewanella loihica PV-4

Annotation: UbiH/UbiF/VisC/COQ6 family ubiquinone biosynthesis hydroxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 12 to 396 (385 residues), 382.3 bits, see alignment E=1.2e-118 PF01266: DAO" amino acids 12 to 44 (33 residues), 28.5 bits, see alignment 2.3e-10 PF01494: FAD_binding_3" amino acids 12 to 346 (335 residues), 97.3 bits, see alignment E=2.3e-31 PF08491: SE" amino acids 250 to 387 (138 residues), 24 bits, see alignment E=4e-09

Best Hits

Swiss-Prot: 49% identical to UBIF_ECOLI: 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (ubiF) from Escherichia coli (strain K12)

KEGG orthology group: K03184, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [EC: 1.14.13.-] (inferred from 100% identity to slo:Shew_2921)

MetaCyc: 49% identical to 3-demethoxyubiquinol 3-hydroxylase (Escherichia coli K-12 substr. MG1655)
OCTAPRENYL-METHYL-METHOXY-BENZOQ-OH-RXN [EC: 1.14.99.60]

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.99.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH39 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Shew_2921 UbiH/UbiF/VisC/COQ6 family ubiquinone biosynthesis hydroxylase (RefSeq) (Shewanella loihica PV-4)
MSQNQRKTLVKDVVVLGGGMVGAATALGLAQLGLSVAVVEAYGPKAYDSEQELDLRVSAI
SVASEQLLERLGALSALGEMRQVAYKGLETWEMEGCITQFHSDQIGASHLGHIVENRLVQ
LALWQQFDRHDNLSLLCPAKVSQFARMEDGIRLTLEDGSEIETRLLVGADGANSQVRQWA
GIGVTGWDYAQSAMLINIATEQEEQDVTWQQFTPKGPRSLLPLPGKHASLVWYDDASRIA
QLQSLSNQALYEQIDAHFPKRLEREFKVLSKGSFKLTRRHAQRYFDDHLVILGDAAHTIN
PLAGQGVNLGFKDVSALIDTFADAIANHKCWWDNEVLKSYQAKRYTDNQLMMTTMDLFYA
GFSNELLPLKLLRNGALKLANIDGPIKQKVLKYAMGL