Protein Info for Shew_2911 in Shewanella loihica PV-4

Annotation: HemK family modification methylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00536: methyltransferase, HemK family
  • amino acids 3 to 278 (276 residues), 268.1 bits, E=7.6e-84
• PF17827: PrmC_N
  • amino acids 7 to 76 (70 residues), 70.9 bits, E=3.8e-23
• TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific
  • amino acids 26 to 274 (249 residues), 283.3 bits, E=1.7e-88
• PF03602: Cons_hypoth95
  • amino acids 95 to 194 (100 residues), 28.7 bits, E=3.7e-10
• PF05175: MTS
  • amino acids 98 to 196 (99 residues), 63.4 bits, E=7.3e-21
• PF13847: Methyltransf_31
  • amino acids 112 to 240 (129 residues), 47.8 bits, E=4.9e-16
• PF13649: Methyltransf_25
  • amino acids 116 to 186 (71 residues), 31.4 bits, E=8.7e-11
• PF08241: Methyltransf_11
  • amino acids 117 to 173 (57 residues), 21.5 bits, E=1.1e-07

Best Hits

Swiss-Prot: 72% identical to PRMC_SHEON: Release factor glutamine methyltransferase (prmC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_2911)

MetaCyc: 51% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

See A3QH29 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Shew_2911 HemK family modification methylase (RefSeq) (Shewanella loihica PV-4)
MFQTLAQALEWASTRLQDVSDSAKLDAEVMLLHIIHKQRSYLYTWPDERLTSEQVTEYKQ
MVGRRELGTPIAHIVGEREFWSLPFMVNPTTLIPRPDTEILVETALNLPLAENAKVLDLG
TGTGAIALSLAFERSNWQITAVDKVLEAVALAKANRDNLKLPQVEVLQSDWFDAINRYDF
NLIVSNPPYIDEEDEHLSQGDVRFEPHSALTAGEHGYADLFYIAEAARDYLAPGGYLLLE
HGFGQALTVRDKMIELGYEAVATVRDFGSNDRCTLGRWPR