Protein Info for Shew_2894 in Shewanella loihica PV-4

Annotation: VanZ family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 39 to 55 (17 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details PF04892: VanZ" amino acids 32 to 107 (76 residues), 36.5 bits, see alignment E=3.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2894)

Predicted SEED Role

"FIG01058682: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH12 at UniProt or InterPro

Protein Sequence (126 amino acids)

>Shew_2894 VanZ family protein (RefSeq) (Shewanella loihica PV-4)
MNSRKTFFKIALLLAIIVISYLVFSRPNYPQVIPHMDKLGHLGSFFCLALLTHLAFEPKW
YSLAGILAGYALFIELVQSRLPYRSASSADFIADMVGVLLFYFGLWLYRRYIKAAVIGKT
RAKTQS