Protein Info for Shew_2866 in Shewanella loihica PV-4

Annotation: acyl-CoA synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 PF00501: AMP-binding" amino acids 41 to 434 (394 residues), 287 bits, see alignment E=2.1e-89 PF13193: AMP-binding_C" amino acids 485 to 559 (75 residues), 72.3 bits, see alignment E=5.3e-24

Best Hits

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 100% identity to slo:Shew_2866)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGY4 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Shew_2866 acyl-CoA synthetase (RefSeq) (Shewanella loihica PV-4)
MNEQTYLQQVKALQAARWPKGTTREPIYPHGEKPVTEYLSAWARLNPTKVAIQFYGYELT
YAQLDEMSTRFANVLRGLGVGQGDGVAVFMPNCPQFHIAFLGILKCGAVHMPVSPLSKEM
ELRHQLGDSQPKVALCYDALLPTMRPVCQELGIEHIITTSYTDVRPRAITAVLPDLFEIP
KTPLADGIIDFFEAIDNASKEVLDYIPALDDLAAINYTSGTTGMPKGVMHTHRNMIGTMA
SYYPVTFGEVGPEGTDLVMLSFLPEFWIAGEDTGLLLPLYSGATLVLMARWDTKAFMELV
HHHKVNMTIMLIDSVDEILNHPHLHQFDLTSLTTVPCISFIKKLNRDYRQRWRELTGTTL
FEVAYGMTETHTCDTFTRGFQVDDMDLSFDPAFLGLPVPGTEIKICDFVTGELMPLGVEG
EIQIRTPTLLKGYWNKPDLNKNLFEEGGWYRTGDLGMITEEGFFRYLGRRKEMLKVNGMS
VFPTEVESMLGQHPAIASCGVVGRPDERKGQVPVAFVTLKPGFDETQESLQAWCVNAMAI
FKVPEIRIQERLPMTATGKIRKVDLEKSL