Protein Info for Shew_2816 in Shewanella loihica PV-4

Annotation: nucleoside-specific channel-forming protein, Tsx (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03502: Channel_Tsx" amino acids 32 to 277 (246 residues), 301.6 bits, see alignment E=2.7e-94

Best Hits

Swiss-Prot: 60% identical to OMPK_VIBPH: Outer membrane protein OmpK (ompK) from Vibrio parahaemolyticus

KEGG orthology group: K05517, nucleoside-specific channel-forming protein (inferred from 100% identity to slo:Shew_2816)

Predicted SEED Role

"Outer membrane protein OmpK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGT4 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Shew_2816 nucleoside-specific channel-forming protein, Tsx (RefSeq) (Shewanella loihica PV-4)
MKNVKTLALAATAVAAMSSSAFAADRSDLYATDYKWMQFNAMYSVDELPSSGESGHNYLE
MEFGGRKGIVDLYGYVDVFNLGNEKAGDKAQGSGASKMFMKFNPRFSLDAITGKDLSFGP
VQELYFSTLFNWGGGAIGEDVNATFWGIGADVNVPWLGKTGMNLYAHYDLNKKEWNGYQF
SANWFKPFYFFENKSFLSFQGYVDWQFGGDEDMGNEFVPMSDNGGAAFFGLYWHSDKYAL
GYGLKGYKDVYLLKDGAGIVGLETTGWGHYFTATYKF