Protein Info for Shew_2810 in Shewanella loihica PV-4

Annotation: phosphoserine phosphatase SerB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR00338: phosphoserine phosphatase SerB" amino acids 114 to 321 (208 residues), 257.9 bits, see alignment E=7.4e-81 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 120 to 290 (171 residues), 82.9 bits, see alignment E=2.7e-27 PF00702: Hydrolase" amino acids 121 to 292 (172 residues), 63.7 bits, see alignment E=4.6e-21 PF12710: HAD" amino acids 122 to 288 (167 residues), 54.5 bits, see alignment E=3.1e-18 PF08282: Hydrolase_3" amino acids 257 to 312 (56 residues), 34.9 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to slo:Shew_2810)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGS8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Shew_2810 phosphoserine phosphatase SerB (RefSeq) (Shewanella loihica PV-4)
MAYQQQNPLFSWLYDEVSASLTLDGCQLTRHEEASAPNADLRLRLVYQGTQCQAIIAEQL
LSSATSVSIALITRQNDLTCIELCLDKQVGQKLADALAARDDIELLYIGDQQPRLDRPGL
LVMDMDSTAIQIECIDELAAMAGVGEAVAEVTERAMQGELDFEQSLRERVAKLAGADAGI
IDTLCAQLPLMPGLEAMVAELQDYGWRLVLASGGFTPFVGHLKQQLNLDAAYANELVIVE
GKLKGEVIGTVVDAQFKADTVLRSAESWQIPMGQRLAIGDGANDIPMVQAADFGIAYHAK
PKLKAAADAAIAKLDLRVLPYMLVNLA