Protein Info for Shew_2796 in Shewanella loihica PV-4

Annotation: periplasmic nitrate reductase NapE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 transmembrane" amino acids 30 to 57 (28 residues), see Phobius details PF06796: NapE" amino acids 20 to 66 (47 residues), 74.1 bits, see alignment E=2.7e-25 TIGR02972: trimethylamine N-oxide reductase system, TorE protein" amino acids 22 to 66 (45 residues), 81.1 bits, see alignment E=1.9e-27

Best Hits

KEGG orthology group: K02571, periplasmic nitrate reductase NapE (inferred from 100% identity to slo:Shew_2796)

Predicted SEED Role

"WARNINIG TorE protein" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGR4 at UniProt or InterPro

Protein Sequence (66 amino acids)

>Shew_2796 periplasmic nitrate reductase NapE (RefSeq) (Shewanella loihica PV-4)
MDKDQLRESVMPSHPISEIRDQDKSKELRALGFIIVMLFPMLTITGISAYGFIIWMIQAF
GGVVAH