Protein Info for Shew_2790 in Shewanella loihica PV-4

Annotation: nucleoside recognition domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 133 to 160 (28 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 345 to 349 (5 residues), see Phobius details amino acids 371 to 389 (19 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details amino acids 426 to 450 (25 residues), see Phobius details PF07670: Gate" amino acids 136 to 233 (98 residues), 52.8 bits, see alignment E=2.4e-18

Best Hits

Swiss-Prot: 49% identical to Y2044_BACPE: Uncharacterized protein BpOF4_10220 (BpOF4_10220) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2790)

Predicted SEED Role

"Predicted arginine uptake transporter" in subsystem Arginine Biosynthesis extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGQ8 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Shew_2790 nucleoside recognition domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MAEKQTHNIKTVLTFLVPSIIGLLLFMTPISYQDAITIPIAIVSKGLQNLLGDSIVAIVT
AIVVLTAIATLICKAAKPTILNRYPFFRALLDVSPMWALVRVLGAIFIVLTFTGTGPEAI
HSGNTGALVLNDLLPVLFCVFIFAGMLLPLLLNFGLLELFGTLLTKVMRPVFNLPGRSAI
DCMASWLGDGSVGILKTSKQYESRFYTQREAAVIGTTFSAVSITFSLVVISQVKLEHLFV
PFYLTVCLAGVVAAIVVPKLPPLSWKKDHYIDETPRHPDDEVIPHGKGVFAWGLEQALTK
AAKAESVGHTLKDGLKNVIDMIFGVIPVVMAIGTVALMIAEYTPIFNYLGMPFIPLLELL
QVPEAAEASKTIVVGFADMFIPSILASSIESDMTRFIIAAMSVTQLIYMSEVGALLIGSK
IPVNILELFVIFILRTLVTLPVIAGVAHLIF