Protein Info for Shew_2761 in Shewanella loihica PV-4

Annotation: putative RNA 2'-O-ribose methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF18125: RlmM_FDX" amino acids 1 to 71 (71 residues), 99.4 bits, see alignment E=1.9e-32 PF21239: RLMM_N" amino acids 84 to 162 (79 residues), 126.8 bits, see alignment E=4.2e-41 PF01728: FtsJ" amino acids 185 to 285 (101 residues), 39.9 bits, see alignment E=6.6e-14

Best Hits

Swiss-Prot: 100% identical to RLMM_SHELP: Ribosomal RNA large subunit methyltransferase M (rlmM) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_2761)

MetaCyc: 58% identical to 23S rRNA 2'-O-ribose C2498 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11589 [EC: 2.1.1.186]

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.186

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGM9 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Shew_2761 putative RNA 2'-O-ribose methyltransferase (RefSeq) (Shewanella loihica PV-4)
MINLFLYCRAGYEKDCAAEIQQRAAELNVGGFVKTNRNDGYVIFQCFQVGDADLLAEQIE
LDSLIFTRQMFAANELLKDLPEGDRVTPIVDALAKVHRAGELRVETPDTNEAKELSTFCR
KLTVPLRQALKRSGALLEKENPKRPIIHVCFVGPGTAYVGYSLSHNSSPYFMGIPRLKMA
SDAPSRSTLKLDEAFIHFIPKSEQEQRLRSGMNSVDLGACPGGWTYQLVRRGMFVAAVDN
GPMAQNLMDTGQVRHYQADGFRFEPPKKNIYWLVCDMVEKPSRVAELMEAWAINGWFKEA
IFNLKLPMKSRYKEVSTILATMQEVLRENGIDDFHLACKHLYHDRDEVTVHLWLKPSVGF
NFG