Protein Info for Shew_2751 in Shewanella loihica PV-4

Name: rdgC
Annotation: recombination associated protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF04381: RdgC" amino acids 1 to 298 (298 residues), 377.4 bits, see alignment E=2.7e-117

Best Hits

Swiss-Prot: 100% identical to RDGC_SHELP: Recombination-associated protein RdgC (rdgC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03554, recombination associated protein RdgC (inferred from 100% identity to slo:Shew_2751)

Predicted SEED Role

"DNA recombination-dependent growth factor C" in subsystem CBSS-562.2.peg.5158 SK3 including or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGL9 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Shew_2751 recombination associated protein (RefSeq) (Shewanella loihica PV-4)
MWFKNLTVYRFNKPFSVDTEALEKSLEDFTFSPCSSQDISKFGFSKALGKLGHTLVHSAE
NRHLICATKEEKILPSQVVKEALEEKVAQIEAEENRKLAKKEKDALKEEITTTLLPRAFS
RRSQIHALILPEIEMILVDSSSATKAEELLALLRKALGSLPVIPMSFKTPIEAQLTEWLK
SNSAPAPFEMQDEAELKSDSDEGGIVRFKQQDLTENEVLAHLEVGKQVHKLALHFGQSIA
FVLQSDAGIKRLKFSEEFRAHNDEVSTEDPLARLDADFALMGSELIALMNSLVEVLGGLE
DSL