Protein Info for Shew_2742 in Shewanella loihica PV-4

Annotation: peptidase M1, membrane alanine aminopeptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF17900: Peptidase_M1_N" amino acids 36 to 207 (172 residues), 45.2 bits, see alignment E=1.7e-15 PF01433: Peptidase_M1" amino acids 242 to 434 (193 residues), 147.6 bits, see alignment E=6.2e-47 PF09127: Leuk-A4-hydro_C" amino acids 494 to 604 (111 residues), 81.4 bits, see alignment E=7.8e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2742)

Predicted SEED Role

"Aminopeptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGL0 at UniProt or InterPro

Protein Sequence (606 amino acids)

>Shew_2742 peptidase M1, membrane alanine aminopeptidase (RefSeq) (Shewanella loihica PV-4)
MAPALHHKKGILVVTQWDNQQDHHSFANVDALRVTHLSLALEVDFAAQQLIGCARLNLDY
REQDCRILYLDTRDLTITSVLDEAGNALVYRVDEQDVVRGQRLAIELSSPSKQVTVHYHT
SPSAQGLQWLSPEQTSGKQLPFLFSQSQPINARSWIPLQDSPKARITFDAKITVPPGMRA
VMSAMNHGDAPLTGEFSFEMEKPIPTHLLAIAVGDLHFGAIGPRTGVYAEPEVLSAAVKE
FEDTEKMVEIAESLLGPYAWDRYDMLILPPSFPFGGMENPRLAFMTPTLIAGDKSLVSTV
AHELAHSWTGNLVSNATWRDLWLNEGFTTYFTNRIVEAVYGKELAELEVVLEYGRLKEEL
VSMPLEAQTLPANVQAGDPNDAFNRFTYDKASMFVHELEHRLGREAFDRFLFEYVNHFAF
EAITTETFVDYARQTLLVQYGDKITEAELLEWVYGEGMPAWFVPPSSDSLEKVDALRAAW
LGGEPINKANTANWRVHHWQYFLNSLPEVLEQEALIDLDTSFDFSRSTNAEIACDWYRVA
IRNHYDPVLPFVEAYLMKIGRGKFVRPLYNELLLAGYGEELRRIYQKARAGYHPSLSVQL
DKQLLQ