Protein Info for Shew_2724 in Shewanella loihica PV-4

Annotation: indigoidine synthase A family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF04227: Indigoidine_A" amino acids 11 to 301 (291 residues), 458.5 bits, see alignment E=4.7e-142

Best Hits

Swiss-Prot: 78% identical to PSUG_HAHCH: Pseudouridine-5'-phosphate glycosidase (psuG) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2724)

MetaCyc: 66% identical to pseudouridine-5'-phosphate glycosidase (Escherichia coli K-12 substr. MG1655)
Pseudouridylate synthase. [EC: 4.2.1.70]

Predicted SEED Role

"Pseudouridine 5'-phosphate glycosidase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGJ2 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Shew_2724 indigoidine synthase A family protein (RefSeq) (Shewanella loihica PV-4)
MLAQYLDINPEVKAALEAGRPVVALESTIISHGMPYPQNVETALKVEQIIRDNGAVPATI
AILKGRLKVGMTHDEIEYLGKAGQAVIKTSRRDIPFIVAKQADGATTVASTMILAAMAGI
KVFATGGIGGVHRGAQQTFDISADLQELANTDVAVVCAGAKSILDIGLTLEYLETQGVPV
VGYETETLPAFYTRESDFGVDYRLDTPKQVADAMTAKWQMGLKGGVVVANPIPAEYALDK
AMIDQVIKDAVAEMDAKGISGKASTPFLLAKVAEKTEGSSLAANIQLVFNNAKLAAQIAC
EYSR