Protein Info for Shew_2704 in Shewanella loihica PV-4

Annotation: Na(+)-translocating NADH-quinone reductase subunit F (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 25 to 27 (3 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details TIGR01941: NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit" amino acids 3 to 405 (403 residues), 750 bits, see alignment E=3.1e-230 PF00111: Fer2" amino acids 42 to 115 (74 residues), 43.3 bits, see alignment E=4.3e-15 PF00970: FAD_binding_6" amino acids 203 to 264 (62 residues), 39.3 bits, see alignment E=1e-13 PF00175: NAD_binding_1" amino acids 275 to 382 (108 residues), 68.6 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 75% identical to NQRF_MANSM: Na(+)-translocating NADH-quinone reductase subunit F (nqrF) from Mannheimia succiniciproducens (strain MBEL55E)

KEGG orthology group: K00351, Na+-transporting NADH:ubiquinone oxidoreductase subunit F [EC: 1.6.5.-] (inferred from 100% identity to slo:Shew_2704)

MetaCyc: 74% identical to Na(+)-translocating NADH-quinone reductase subunit F (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit F (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGH2 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Shew_2704 Na(+)-translocating NADH-quinone reductase subunit F (RefSeq) (Shewanella loihica PV-4)
MEMAIGIGMFTIVVCVLVMVILVAKSKLVINGDVSIRINDDDDKSITTAAGDKLLGALAS
KNIFIPSACGGGGTCGQCRVKVKSGGGDILPTERDHINKKEAKEGCRLACQVAVKTDMEL
ELEEEIFGVKKWQCEVISNDNQATFIKELLLKLPEGEDVKFKAGGYIQIEAPAHEVKYSD
FDIPTEYRDDWEKYGLFDLVSTVEEDVLRAYSMANYPDEKGVIMLNVRIATPPSEGLPPG
KMSSYIFNLKAGDKVTISGPFGEFFVKETDAEMVFIGGGAGMAPMRSHIFNQLKGEQTKR
KMTFWYGARSRREIFYQEEFDALAAENDNFEWHVALSDPLPEDNWDGYTGFIHNVLYENY
LKNHKAPEDCEFYMCGPPIMNSSVINMLESLGVEQENILLDDFGD