Protein Info for Shew_2679 in Shewanella loihica PV-4

Annotation: FAD dependent oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01266: DAO" amino acids 7 to 54 (48 residues), 36 bits, see alignment 2.8e-12 amino acids 111 to 330 (220 residues), 32.3 bits, see alignment E=3.6e-11 PF12831: FAD_oxidored" amino acids 7 to 157 (151 residues), 31.4 bits, see alignment E=5.8e-11 PF01494: FAD_binding_3" amino acids 7 to 173 (167 residues), 38.5 bits, see alignment E=3.8e-13 PF07992: Pyr_redox_2" amino acids 7 to 165 (159 residues), 35.4 bits, see alignment E=3.7e-12 PF00890: FAD_binding_2" amino acids 7 to 42 (36 residues), 30.5 bits, see alignment 1e-10 PF01134: GIDA" amino acids 7 to 162 (156 residues), 30.8 bits, see alignment E=7.5e-11 PF13450: NAD_binding_8" amino acids 10 to 41 (32 residues), 35.9 bits, see alignment (E = 3.4e-12)

Best Hits

Swiss-Prot: 64% identical to FIXC_SALTI: Protein FixC (fixC) from Salmonella typhi

KEGG orthology group: K00313, electron transfer flavoprotein-quinone oxidoreductase [EC: 1.5.5.-] (inferred from 100% identity to slo:Shew_2679)

Predicted SEED Role

"Probable electron transfer flavoprotein-quinone oxidoreductase FixC (EC 1.5.5.-)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 1.5.5.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGE7 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Shew_2679 FAD dependent oxidoreductase (RefSeq) (Shewanella loihica PV-4)
MSEEAFDAIIVGAGLAGCVAAYVLAKEGADVLVIERGNYAGSKNMTGGRLYAHSLERIIP
GFAKEAPIERKVTKEKVTFLTDDTGVTLDYHNGRDQSPLQESYTLLRGEFDQWLMGKAEE
VGAQFITGIRVDEILTQDGKVIGVKADGDELTAKAVILAEGVNPILGEQLGMVKPKVSAD
AMAVGAKELIELPESVIKDRFNLKDDEGAAWLFAGSPSNGLMGGGFIYTNRNSISLGIVC
GLHGIGESDKSVPQMLEDFKNHSLIKPLIEGGKLLEYSGHVVPEAGLNMVPKLVDHGVLI
TGDAAGFCLNVGYTVRGMDLAIASGEAAAKAVLAARAQQDFSAQGLSSYQSLLEESFLMK
DMKLYKQLPAFMETPRIFNQYPKMVADIMHEMFIIDGTPAQPLRKTLLKHCKEVGFMNLI
KDGYKGVTSI