Protein Info for Shew_2678 in Shewanella loihica PV-4

Annotation: electron transfer flavoprotein, alpha subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF01012: ETF" amino acids 19 to 164 (146 residues), 87.4 bits, see alignment E=1.1e-28 PF00766: ETF_alpha" amino acids 191 to 270 (80 residues), 94.5 bits, see alignment E=3.2e-31

Best Hits

Swiss-Prot: 57% identical to FIXB_SALPA: Protein FixB (fixB) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 100% identity to slo:Shew_2678)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit FixB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGE6 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Shew_2678 electron transfer flavoprotein, alpha subunit (RefSeq) (Shewanella loihica PV-4)
MSKLSNVWVFSDIATRLPETIAGGRALGEKVSAFIIGSEADIATAYSYGATHVYYLGNKA
DAQMVEDYAATMSQAINDGDKPTLVLLPATKRCKALAAKLSVQLEAGLINDATEVSLDEG
VTAKHMVYGGLAIGTERITSPVALVTLASGAFEPQAADTSLTGEGVSLAFVAPKQAIRCI
ERRVKQGNSVDLGKAKRVIAVGSGIGNLDNLALAGELATAIQAELGCSRPIAETEKWMER
ERYVGVSGVMLKPDIYLALGISGQIQHMVGALGSQTILAVNKDKNAPIFQYVDYGLVGDI
NKVLPALIQAMKG