Protein Info for Shew_2676 in Shewanella loihica PV-4

Annotation: L-carnitine/gamma-butyrobetaine antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 24 to 40 (17 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 415 to 438 (24 residues), see Phobius details amino acids 455 to 477 (23 residues), see Phobius details amino acids 484 to 504 (21 residues), see Phobius details PF02028: BCCT" amino acids 24 to 509 (486 residues), 389.2 bits, see alignment E=1.3e-120 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 62 to 509 (448 residues), 469.3 bits, see alignment E=6.1e-145

Best Hits

Swiss-Prot: 69% identical to CAIT_SALPK: L-carnitine/gamma-butyrobetaine antiporter (caiT) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K05245, L-carnitine/gamma-butyrobetaine antiporter (inferred from 100% identity to slo:Shew_2676)

MetaCyc: 68% identical to L-carnitine:gamma-butyrobetaine antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-100

Predicted SEED Role

"L-carnitine/gamma-butyrobetaine antiporter"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGE4 at UniProt or InterPro

Protein Sequence (514 amino acids)

>Shew_2676 L-carnitine/gamma-butyrobetaine antiporter (RefSeq) (Shewanella loihica PV-4)
MNEKTMGFDLAEGKKKKVTIEPKIFFPSLIAVILLSYLTVRDLDAANVVIKEVFHYLTHS
WGWAFEWYMIALAIGWGWLVWGPYANNRLGQEKPEFSTGSWIFLMFASCTSAAVLYWGSL
EAYYYLTYPPFEIQSMSVQAKELGVAYSLFHWGPLPWMGYGFFTVALGYFLFVKKMDVVR
PSGTLAPVLGKHHKGILGTFIDNIYVVALILAMGTSLGLATPLVTECIQWLFGIERTIEV
DTFVISVWIIFNAVCVAFGLTKGIKIASDLRSYLSIIMLFWVFLIGATSFTVNYFTESVG
VMLAYLPRMLFYTSSISADSWPQDWTVFYWAWWVVYGIQMCIFLAKISRGRTVRELCLTM
VLGLTASTWFLWTILGSNTVNLMHESIINMGQLIQDHGAPRAIIETWAALPMSTITMWGF
FILCFLATVTLINACSYTLAMSTCKGADADNEPPVWIRVGWSVLVGVIGIVLLSLGGLKP
LQTAIIAGGAPLVIVNILVIISFLKDARKNNWAS